Protein coding transcript 253840

• Transcript: Ll_transcript_177792
• CDS coordinates: 1513-1824 (+)
• Peptide sequence: MKQVQGSPVTPVNSNSSSSDPVTPWIISEEIDSGTNTSYAGEINHNSAVQSHELRLHEINTLEWDDLVLVNDLNTSTVPNEAKVQNFDQQNQALLNNSFNNVR*
• ORF Type: complete

Annotations of Ll_transcript_177792

• Blastp: Calmodulin-binding transcription activator 5 from Arabidopsis with 42.55% of identity
• Blastx: Calmodulin-binding transcription activator 5 from Arabidopsis with 81.82% of identity
• Eggnog: Transcription activator(ENOG410XS5M)
• Kegg: Link to kegg annotations (AT4G15200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455972.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;