Protein coding transcript 253849

• Transcript: Ll_transcript_177776
• CDS coordinates: 2-757 (+)
• Peptide sequence: SSTEKSKVLVTGFFHKDYQHLSKSNLLCVCGDVSVPAEIVQAGVYRCWVSPHSPGFVNLYLSFDGHKPISQVVNFEYRTTVLHDPAVSMEQKDNWDEFQLQMKLAHLLFAKQNILDVFSSNISPNALKGARQFAIKTSYISNSWQYLMKSTEDNKIPFSQAKDALFGIALKNRLKDWLLERIVLGCKTTEFDAQGQSVIHLCAILEYTWAVSLFSWAGLSLDFRDKFGWTALHWAACYGRCIHKYPTCLNH*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_177776

• Blastp: Calmodulin-binding transcription activator 6 from Arabidopsis with 59.58% of identity
• Blastx: Calmodulin-binding transcription activator 6 from Arabidopsis with 59.58% of identity
• Eggnog: Transcription activator(ENOG410XS5M)
• Kegg: Link to kegg annotations (AT3G16940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455972.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;