Protein coding transcript 253850

• Transcript: Ll_transcript_177781
• CDS coordinates: 2-763 (+)
• Peptide sequence: SSTEKSKVLVTGFFHKDYQHLSKSNLLCVCGDVSVPAEIVQAGVYRCWVSPHSPGFVNLYLSFDGHKPISQVVNFEYRTTVLHDPAVSMEQKDNWDEFQLQMKLAHLLFAKQNILDVFSSNISPNALKGARQFAIKTSYISNSWQYLMKSTEDNKIPFSQAKDALFGIALKNRLKDWLLERIVLGCKTTEFDAQGQSVIHLCAILEYTWAVSLFSWAGLSLDFRDKFGWTALHWAACYGREKMVATLLSAGAKP
• ORF Type: internal

Annotations of Ll_transcript_177781

• Blastp: Calmodulin-binding transcription activator 6 from Arabidopsis with 61.02% of identity
• Blastx: Calmodulin-binding transcription activator 6 from Arabidopsis with 61.02% of identity
• Eggnog: Transcription activator(ENOG410XS5M)
• Kegg: Link to kegg annotations (AT3G16940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455972.1)
• Pfam: Ankyrin repeats (3 copies) (PF12796.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;