Protein coding transcript 253949

• Transcript: Ll_transcript_36160
• CDS coordinates: 371-739 (+)
• Peptide sequence: MVEPHLNGHPEHLHLGTGGDKKCEMIKNDLLWQPISDSEKRTRNIGPKSKRLLIHSEDAMELRLTWEEAQGLLHPPPSVKPNVVTIEDQEIEEYHEPPVIGKRTIFNASPTGIQHYFLFKIH*
• ORF Type: complete

Annotations of Ll_transcript_36160

• Blastp: B3 domain-containing transcription repressor VAL2 from Arabidopsis with 48.78% of identity
• Blastx: B3 domain-containing transcription repressor VAL1 from Arabidopsis with 51.35% of identity
• Eggnog: B3 domain-containing protein(ENOG410Z235)
• Kegg: Link to kegg annotations (AT4G32010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455744.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;