Protein coding transcript 253953

• Transcript: Ll_transcript_36166
• CDS coordinates: 1834-2358 (+)
• Peptide sequence: MYVLEGVTPCIQAMQLCAGDTVTFNRIDPGGKLVVGFRKASNSIDTQDASPSSLSNGISMKGTTNSGGTENLPLDSSYADLLQSIKGNGESHINGHPEHLHFGAGAVGFLTTENCEKTNKQSPQQPIPFSEKKRTHNIGPKSKRLRIDNEDAMELRLTWEEAQHLLRPPPSVQPS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_36166

• Blastp: B3 domain-containing protein Os07g0679700 from Oryza sativa with 47.73% of identity
• Blastx: B3 domain-containing protein Os07g0679700 from Oryza sativa with 57.2% of identity
• Eggnog: B3 domain-containing protein(ENOG410Z235)
• Kegg: Link to kegg annotations (4344293)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430569.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;