Transcript | Ll_transcript_36167 |
---|---|
CDS coordinates | 1752-2276 (+) |
Peptide sequence | MYVLEGVTPCIQAMQLCAGDTVTFNRIDPGGKLVVGFRKASNSIDTQDASPSSLSNGISMKGTTNSGGTENLPLDSSYADLLQSIKGNGESHINGHPEHLHFGAGAVGFLTTENCEKTNKQSPQQPIPFSEKKRTHNIGPKSKRLRIDNEDAMELRLTWEEAQHLLRPPPSVQPS |
ORF Type | 3prime_partial |
Blastp | B3 domain-containing protein Os07g0679700 from Oryza sativa with 47.73% of identity |
---|---|
Blastx | B3 domain-containing protein Os07g0679700 from Oryza sativa with 57.2% of identity |
Eggnog | B3 domain-containing protein(ENOG410Z235) |
Kegg | Link to kegg annotations (4344293) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430569.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer