Protein coding transcript 253969

• Transcript: Ll_transcript_36187
• CDS coordinates: 2-322 (+)
• Peptide sequence: FYALQFLHALSLSSFSLSIFLFCLSLSTKKKKTTHTSFSFNPIHTFTLSLSKIKLNFELMGSDIYVNALCVHDWKKGWPLRSGGFAQLCTKCGFMEEWKHGILDPL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_36187

• Blastp: B3 domain-containing protein Os07g0679700 from Oryza sativa with 72% of identity
• Blastx: B3 domain-containing protein Os07g0679700 from Oryza sativa with 72% of identity
• Eggnog: B3 domain-containing protein(ENOG410Z235)
• Kegg: Link to kegg annotations (4344293)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419345.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;