Transcript | Ll_transcript_34611 |
---|---|
CDS coordinates | 205-531 (+) |
Peptide sequence | MELLEKLKMRKKKQPDNNEVEGGSVLWFETSVSVSRRFQFEPQGQLSVKIVDDSRPLHSRIVESFLHKFFPSGYPYSVNEGYLTYTQFRAMQHITSAALSVLSTQVFF* |
ORF Type | complete |
Blastp | Protein root UVB sensitive 2, chloroplastic from Arabidopsis with 65.38% of identity |
---|---|
Blastx | Protein root UVB sensitive 2, chloroplastic from Arabidopsis with 74.07% of identity |
Eggnog | Chromosome 16 open reading frame 58(ENOG410XU74) |
Kegg | Link to kegg annotations (AT2G31190) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429195.1) |
Pfam | Vitamin B6 photo-protection and homoeostasis (PF04884.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer