Transcript | Ll_transcript_34620 |
---|---|
CDS coordinates | 476-814 (+) |
Peptide sequence | MQLDDSLLKKIETSSGQELKESRDLIRRIRRRDIYQFCNEFSVPKDRLEHFKDITSQDIVCSQLDGTSLKEDDVAVSIVKIDLTHGSKNPVERCLKEMMITIKAVYLFFYIC* |
ORF Type | complete |
Blastp | Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 homolog from Dictyostelium with 35.87% of identity |
---|---|
Blastx | Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 homolog from Dictyostelium with 30.14% of identity |
Eggnog | Metal Dependent Phosphohydrolase(COG1078) |
Kegg | Link to kegg annotations (DDB_G0272484) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439192.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer