Protein coding transcript 254057

• Transcript: Ll_transcript_35886
• CDS coordinates: 178-1113 (+)
• Peptide sequence: MDMERIIGGKFKIGRKIGSGSFGHIYIASNIDTSEIVAVKMESKKSKHPQLLYEAKLYNFIQGEPGIPSLKWCGTDGDNNVLVIDLLGPSLEDLFVYCGRKFSLKTVLMLADQMLTRIEYVHSKGFLHRDIKPDNFLIGLGRRANQVYIIDFGLAKRYMDPNTNKHISYRENKNLTGTARYASCNTHLGFEQSRRDDLESLGYVLMYFLRGSLPWQGLKAVTKKEKYDRICEKKLSTSVEMLCTSYPVEFTSYFNYCRSLTFDERPDYGFLKQLFRDMFTREGYASDNLFDWTILKYQQAQLAKRQNPSSPA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_35886

• Blastp: Casein kinase 1-like protein 3 from Arabidopsis with 76.77% of identity
• Blastx: Casein kinase 1-like protein 3 from Arabidopsis with 76.29% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT4G28880)
• CantataDB: Link to cantataDB annotations (CNT0000700)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415754.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;