Protein coding transcript 254061

• Transcript: Ll_transcript_35868
• CDS coordinates: 613-1116 (+)
• Peptide sequence: MLYYFKFNSPRYHYLIFVLTMMISSRENKSLTGTARYASCNTHIGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAVTKKEKYDRICEKKLSTSVEMLCTSYPVEFTSYFNYCRSLTFDERPDYGFLKQLFRDMFTREGYASDNLFDWTILKYQQAQLAKRQNPSSPA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_35868

• Blastp: Casein kinase 1-like protein 3 from Arabidopsis with 74.66% of identity
• Blastx: Casein kinase 1-like protein 3 from Arabidopsis with 74.66% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT4G28880)
• CantataDB: Link to cantataDB annotations (CNT0000700)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019415754.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;