Protein coding transcript 254065

• Transcript: Ll_transcript_35879
• CDS coordinates: 282-728 (+)
• Peptide sequence: MDMERIIGGKFKVGRKIGSGSFGQIYIASNIETSEIVAIKMESKKAKHPQLLYEAKLYNFLQGETGIPSMKWCGTDGDNNVLVIDILGPSLEDLFVYCGRKFSLKTVLMLADQMLTRIEYVHSKGFLHRDIKPDNFLMGLGRKASQVI*
• ORF Type: complete

Annotations of Ll_transcript_35879

• Blastp: Casein kinase 1-like protein 4 from Arabidopsis with 77.24% of identity
• Blastx: Casein kinase 1-like protein 4 from Arabidopsis with 75% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT4G28860)
• CantataDB: Link to cantataDB annotations (CNT0000700)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432250.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;