Transcript | Ll_transcript_35866 |
---|---|
CDS coordinates | 637-963 (+) |
Peptide sequence | MNDSAVNKDATLSSTNFLGQSSGSRRVALSGSREAFAGSESDIRTRTTEFSSGAAYKISSGQKSSPLGSSDPKRVVPSGRNASHVKNYEAAVKGIEGLQLENEERTHH* |
ORF Type | complete |
Blastp | Casein kinase 1-like protein 1 from Arabidopsis with 34.95% of identity |
---|---|
Blastx | Casein kinase 1-like protein 1 from Arabidopsis with 55.45% of identity |
Eggnog | Casein Kinase(ENOG410XPGP) |
Kegg | Link to kegg annotations (AT4G26100) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415527.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer