Protein coding transcript 254076

• Transcript: Ll_transcript_35883
• CDS coordinates: 2581-2961 (+)
• Peptide sequence: MPGPVVNSASFSKQKSPIMNDSAVNKDAALSSNNFMGQSSGSRRFALSGSREAFVGSESDIRTRTTEAGSGAAYKISSGQKSSPIGSSDPKRAVSSARNTSDGKNYESAVKGIEGLQLENDERTHH*
• ORF Type: complete

Annotations of Ll_transcript_35883

• Blastp: Casein kinase 1-like protein 2 from Arabidopsis with 44.54% of identity
• Blastx: Casein kinase 1-like protein 2 from Arabidopsis with 84.5% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT1G72710)
• CantataDB: Link to cantataDB annotations (CNT0002396)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437556.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;