Protein coding transcript 2541

• Transcript: Ll_transcript_281135
• CDS coordinates: 165-506 (+)
• Peptide sequence: MEHGSFSDQSKSTFSLVDEDHTFANSVRFTLNQDPRVTFVGYSIPHPSDNRVNIRVQTTGDPAREVLKDGCQELMLMCQHVRSTFDKAVSDFKIKAAKTKTVDEDSDDDMDSE*
• ORF Type: complete

Annotations of Ll_transcript_281135

• Blastp: DNA-directed RNA polymerases I and III subunit RPAC2 from Mus with 39.6% of identity
• Blastx: DNA-directed RNA polymerases I and III subunit RPAC2 from Xenopus with 44.32% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates(COG1761)
• Kegg: Link to kegg annotations (20018)
• CantataDB: Link to cantataDB annotations (CNT0001964)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453001.1)
• Pfam: RNA polymerase Rpb3/Rpb11 dimerisation domain (PF13656.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;