Protein coding transcript 254130

• Transcript: Ll_transcript_36059
• CDS coordinates: 2045-2572 (+)
• Peptide sequence: MLVVDPMKRMTIPEIRQHPWFQARLPRYLAVPPPDTMQQAKKIDEEILQEVVNMGFDRNQLVESLCNRLQNEGTVAYYLLLDNRFRVSSGYLGAEFQETLDSGFNRIHSSEVASPVVGNRFPGYIDYQGVGMRPQFPVERKWALGLQSRAHPREIMTEVLKALQELNVSWKKIGHY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_36059

• Blastp: SNF1-related protein kinase catalytic subunit alpha KIN10 from Arabidopsis with 79.55% of identity
• Blastx: SNF1-related protein kinase catalytic subunit alpha KIN10 from Arabidopsis with 98.76% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT3G01090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452949.1)
• Pfam: UBA/TS-N domain (PF00627.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;