Transcript | Ll_transcript_36088 |
---|---|
CDS coordinates | 2091-2714 (+) |
Peptide sequence | MLVVDPMKRMTIPEIRQHPWFQARLPRYLAVPPPDTMQQAKKIDEEILQEVVNMGFDKNQLVESLRNRLQNEGTVAYYLLLDNRFRVSSGYLGAEFQETMDSGFNRVHSSEVVSPVVGNRFPGYIDYQGAGVRPQFPVERKWALGLQSRAHPREIMTEVLKALQELNVSWKKIGHYNMKCRWATGIPVHQEGMVNNSVHDDHYFGNDS |
ORF Type | 3prime_partial |
Blastp | SNF1-related protein kinase catalytic subunit alpha KIN10 from Arabidopsis with 75.48% of identity |
---|---|
Blastx | SNF1-related protein kinase catalytic subunit alpha KIN10 from Arabidopsis with 77.63% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT3G01090) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428432.1) |
Pfam | UBA/TS-N domain (PF00627.30) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer