Transcript | Ll_transcript_34838 |
---|---|
CDS coordinates | 294-1487 (+) |
Peptide sequence | MCMHDEATTHYIDMIDQTTLGHQFLKEEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKDEKTLEVVWQGSKSLGYTAQIFSGAFPNNYEPPTSNFYFEVNDDSPVVQDDVDLFDYNVPDRVNEFVSAAIAQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDARVHALYSTPSIYTDAKHAANEAWPLKTDDFFPYADRINAYWTGYFTSRPALKGYARLMSSYYLAARQLEYFKGKSVSGPKTDSLAEALAIAQHHDAVSGTSKQHVANDYAKRLSIGYTEAEKVVAESLAYLTDAATKTDSRSSQIKFQQCPLLNITYCSASEVDLSYGKDLVVVIYNPLGWKRDDVIRIPVANEKVVVRDSSGKEIQSQL |
ORF Type | 3prime_partial |
Blastp | Probable alpha-mannosidase At5g13980 from Arabidopsis with 75.88% of identity |
---|---|
Blastx | Probable alpha-mannosidase At5g13980 from Arabidopsis with 76.06% of identity |
Eggnog | Mannosidase alpha class(ENOG410XQMZ) |
Kegg | Link to kegg annotations (AT5G13980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430110.1) |
Pfam | Glycosyl hydrolases family 38 N-terminal domain (PF01074.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer