Protein coding transcript 254217

• Transcript: Ll_transcript_34842
• CDS coordinates: 294-1472 (+)
• Peptide sequence: MCMHDEATTHYIDMIDQTTLGHQFLKEEFGVTPRIGWQIDPFGHSAVQAYLLGAEVGFDSLFFARIDYQDRAKRKDEKTLEVVWQGSKSLGYTAQIFSGAFPNNYEPPTSNFYFEVNDDSPVVQDDVDLFDYNVPDRVNEFVSAAIAQANITRTNHIMWTMGTDFKYQYAHTWFRQMDKFIHYVNQDARVHALYSTPSIYTDAKHAANEAWPLKTDDFFPYADRINAYWTGYFTSRPALKGYARLMSSYYLAARQLEYFKGKSVSGPKTDSLAEALAIAQHHDAVSGTSKQHVANDYAKRLSIGYTEAEKVVAESLAYLTDAATKTDSRSSQIKFQQCPLLNITYCSASEVDLSYGKDLVVVIYNPLGWKRDDVIRIPVSLFLHALLLYFLQ*
• ORF Type: complete

Annotations of Ll_transcript_34842

• Blastp: Probable alpha-mannosidase At5g13980 from Arabidopsis with 77.31% of identity
• Blastx: Probable alpha-mannosidase At5g13980 from Arabidopsis with 77.49% of identity
• Eggnog: Mannosidase alpha class(ENOG410XQMZ)
• Kegg: Link to kegg annotations (AT5G13980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430110.1)
• Pfam: Glycosyl hydrolases family 38 N-terminal domain (PF01074.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;