Protein coding transcript 254262

• Transcript: Ll_transcript_35944
• CDS coordinates: 1322-2008 (+)
• Peptide sequence: MHILIILYLSNSCRMGSMRMGGCLSLIICVLLLLKAEAISVSISFVENAVAKGAVCLDGSPPAYHFDKGFGAGINNWIVHVEGGGWCNNVTTCLARKDTRLGSSKKMDGVVSFSGFFSNKQKFNPDFYDWNRIKVRYCDGASFTGDIEAVDPATNLHFRGARVFVAVIEELLAKGMKNAQNVKEIDNSRLFSILSNFFFTFSPKLVTTGYFLRVFSWRIDYYTTLRSL*
• ORF Type: complete

Annotations of Ll_transcript_35944

• Blastp: Pectin acetylesterase 8 from Arabidopsis with 67.3% of identity
• Blastx: Pectin acetylesterase 8 from Arabidopsis with 61.9% of identity
• Eggnog: pectinacetylesterase(ENOG410XQKD)
• Kegg: Link to kegg annotations (AT4G19420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421190.1)
• Pfam: Pectinacetylesterase (PF03283.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;