Transcript | Ll_transcript_35944 |
---|---|
CDS coordinates | 1322-2008 (+) |
Peptide sequence | MHILIILYLSNSCRMGSMRMGGCLSLIICVLLLLKAEAISVSISFVENAVAKGAVCLDGSPPAYHFDKGFGAGINNWIVHVEGGGWCNNVTTCLARKDTRLGSSKKMDGVVSFSGFFSNKQKFNPDFYDWNRIKVRYCDGASFTGDIEAVDPATNLHFRGARVFVAVIEELLAKGMKNAQNVKEIDNSRLFSILSNFFFTFSPKLVTTGYFLRVFSWRIDYYTTLRSL* |
ORF Type | complete |
Blastp | Pectin acetylesterase 8 from Arabidopsis with 67.3% of identity |
---|---|
Blastx | Pectin acetylesterase 8 from Arabidopsis with 61.9% of identity |
Eggnog | pectinacetylesterase(ENOG410XQKD) |
Kegg | Link to kegg annotations (AT4G19420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421190.1) |
Pfam | Pectinacetylesterase (PF03283.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer