Protein coding transcript 254279

• Transcript: Ll_transcript_35940
• CDS coordinates: 234-536 (+)
• Peptide sequence: MGSRVKGRTVLDVGADGVAIITIINPPVNSLSFDVLRSLKESFDQALQRNDVKAIVVTGAKGKFSGGFDISAFGGIQEGKENSSPGWISIEIVTDTVEGT*
• ORF Type: complete

Annotations of Ll_transcript_35940

• Blastp: Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a from Cucumis with 71.29% of identity
• Blastx: Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a from Cucumis with 71.29% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101210295)
• CantataDB: Link to cantataDB annotations (CNT0000094)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419537.1)
• Pfam: Enoyl-CoA hydratase/isomerase (PF00378.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;