Transcript | Ll_transcript_35904 |
---|---|
CDS coordinates | 1290-1790 (+) |
Peptide sequence | MFFPYTQAGLLLVERGADVYQIDEAITKFGMPMGPFRLADLVGFGVAVATGTQFIRNFPERTYKSMLIPLLQEDKRTGEATHKGFYLYDDKRKASVDPELKNFIEKARSISGVSIDPKLVKLQETDIIEMILFPVVNEACRILDEGIAVKADDLDISAVMGMGFPP* |
ORF Type | complete |
Blastp | Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 from Arabidopsis with 78.31% of identity |
---|---|
Blastx | Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 from Arabidopsis with 76.87% of identity |
Eggnog | Enoyl-CoA hydratase(COG1024) |
Kegg | Link to kegg annotations (AT3G06860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004508202.1) |
Pfam | 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain (PF00725.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer