Protein coding transcript 254288

• Transcript: Ll_transcript_35930
• CDS coordinates: 1655-2155 (+)
• Peptide sequence: MFFPYTQAGLLLVERGADVYQIDEAITKFGMPMGPFRLADLVGFGVAVATGTQFIRNFPERTYKSMLIPLLQEDKRTGEATHKGFYLYDDKRKASVDPELKNFIEKARSISGVSIDPKLVKLQETDIIEMILFPVVNEACRILDEGIAVKADDLDISAVMGMGFPP*
• ORF Type: complete

Annotations of Ll_transcript_35930

• Blastp: Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 from Arabidopsis with 78.31% of identity
• Blastx: Peroxisomal fatty acid beta-oxidation multifunctional protein MFP2 from Arabidopsis with 77.7% of identity
• Eggnog: Enoyl-CoA hydratase(COG1024)
• Kegg: Link to kegg annotations (AT3G06860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003529561.1)
• Pfam: 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain (PF00725.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;