Protein coding transcript 254291

• Transcript: Ll_transcript_33624
• CDS coordinates: 139-579 (+)
• Peptide sequence: MLPFYVINSCPYPRFLHISPMCFTQVMFLMEFLTITKFYLCFLVILSIATTILNPVSATKPCNFPAIFNLGDSNSDTGGLAASLLAPTPPYGETYFHRPSGRFSDGRLIIDFIAQSFGLSYLSAYLDSLGTNFSHGANFATSASTIR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_33624

• Blastp: GDSL esterase/lipase At3g26430 from Arabidopsis with 65% of identity
• Blastx: GDSL esterase/lipase At3g26430 from Arabidopsis with 65% of identity
• Eggnog: GDSL esterase lipase(ENOG410Y9BR)
• Kegg: Link to kegg annotations (AT3G26430)
• CantataDB: Link to cantataDB annotations (CNT0000811)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461533.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;