Transcript | Ll_transcript_34560 |
---|---|
CDS coordinates | 1934-2710 (+) |
Peptide sequence | MMGEKIDPSIIIYFLCRSTNLDSWSPEQLKTMSFGGNNRAQVFFKQHGWTDGGKIEAKYTSRAAELYKQILSKEVSKSMAEEAGLASSVVAVQSPQVANGLPEVRTNELPKENSLGKPETPESTSSPRASHTTFSSTVKKSIGAKKTGKTGGLGARKLTKKPSESLYEQKPEEPPAPVSSPAIKNLPTVPPQPSRFGYVENVQSSDLNSRAGDTDVHGHVSVPKSSSFFADFGMDSGFPKKSVSNSSKVQVSHIAATF* |
ORF Type | complete |
Blastp | Probable ADP-ribosylation factor GTPase-activating protein AGD8 from Arabidopsis with 60.78% of identity |
---|---|
Blastx | Probable ADP-ribosylation factor GTPase-activating protein AGD8 from Arabidopsis with 55.56% of identity |
Eggnog | domain, ankyrin repeat and PH domain(COG5347) |
Kegg | Link to kegg annotations (AT4G17890) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445317.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer