Protein coding transcript 254318

• Transcript: Ll_transcript_34531
• CDS coordinates: 132-464 (+)
• Peptide sequence: MASSDPFTDKNIVFRKLKAKSENKMCFDCNAKNPTWASVTYGIFLCIDCSAAHRSLGVHISFVRSTNLDSWSPEQLKTMSFGGNNRAQVFFKQHGWTDGGKIEAKYTSRAA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_34531

• Blastp: Probable ADP-ribosylation factor GTPase-activating protein AGD8 from Arabidopsis with 90% of identity
• Blastx: Probable ADP-ribosylation factor GTPase-activating protein AGD8 from Arabidopsis with 90% of identity
• Eggnog: domain, ankyrin repeat and PH domain(COG5347)
• Kegg: Link to kegg annotations (AT4G17890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424298.1)
• Pfam: Putative GTPase activating protein for Arf (PF01412.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;