Protein coding transcript 254354

• Transcript: Ll_transcript_35805
• CDS coordinates: 127-465 (+)
• Peptide sequence: MALSSPQTQRFILTNNLHTPSTSKNTHRSTSSNCFTTTTSRRSRCCSAIAIDAPSSLAEAPGIRWGSIALQGMREEMEDDIIVLPDSLHGFSFAAVFDGHGGVSSVQFLRTE*
• ORF Type: complete

Annotations of Ll_transcript_35805

• Blastp: Protein phosphatase 2C 57 from Arabidopsis with 48.21% of identity
• Blastx: Protein phosphatase 2C 57 from Arabidopsis with 63.08% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT4G27800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437352.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;