Protein coding transcript 254355

• Transcript: Ll_transcript_35808
• CDS coordinates: 127-471 (+)
• Peptide sequence: MALSSPQTQRFILTNNLHTPSTSKNTHRSTSSNCFTTTTSRRSRCCSAIAIDAPSSLAEAPGIRWGSIALQGMREEMEDDIIVLPDSLHGFSFAAVFDGHGGVSSVQFLRSLLA*
• ORF Type: complete

Annotations of Ll_transcript_35808

• Blastp: Protein phosphatase 2C 57 from Arabidopsis with 47.79% of identity
• Blastx: Protein phosphatase 2C 57 from Arabidopsis with 62.12% of identity
• Eggnog: Phosphatase(COG0631)
• Kegg: Link to kegg annotations (AT4G27800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437352.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;