Transcript | Ll_transcript_35809 |
---|---|
CDS coordinates | 127-540 (+) |
Peptide sequence | MALSSPQTQRFILTNNLHTPSTSKNTHRSTSSNCFTTTTSRRSRCCSAIAIDAPSSLAEAPGIRWGSIALQGMREEMEDDIIVLPDSLHGFSFAAVFDGHGGVSSVQFLRDELYKECHEALQGGLLLVEKDFKAIKEA |
ORF Type | 3prime_partial |
Blastp | Protein phosphatase 2C 57 from Arabidopsis with 52.17% of identity |
---|---|
Blastx | Protein phosphatase 2C 57 from Arabidopsis with 64.84% of identity |
Eggnog | Phosphatase(COG0631) |
Kegg | Link to kegg annotations (AT4G27800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437352.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer