| Transcript | Ll_transcript_35809 |
|---|---|
| CDS coordinates | 127-540 (+) |
| Peptide sequence | MALSSPQTQRFILTNNLHTPSTSKNTHRSTSSNCFTTTTSRRSRCCSAIAIDAPSSLAEAPGIRWGSIALQGMREEMEDDIIVLPDSLHGFSFAAVFDGHGGVSSVQFLRDELYKECHEALQGGLLLVEKDFKAIKEA |
| ORF Type | 3prime_partial |
| Blastp | Protein phosphatase 2C 57 from Arabidopsis with 52.17% of identity |
|---|---|
| Blastx | Protein phosphatase 2C 57 from Arabidopsis with 64.84% of identity |
| Eggnog | Phosphatase(COG0631) |
| Kegg | Link to kegg annotations (AT4G27800) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019437352.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer