Transcript | Ll_transcript_33944 |
---|---|
CDS coordinates | 751-1302 (+) |
Peptide sequence | MAIGNFCICSIAVGMLVEIIVMYPIQRRKYRDGIDNLLVLLMGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVEKNLIEVFAKGVDKEHVMLLAARASRTENQDAIDTAIVGMLADPKEARAGIREVHFLPFNPNDKRTALTYIDANGNWHRASKG |
ORF Type | 3prime_partial |
Blastp | Plasma membrane ATPase 4 from Nicotiana with 91.8% of identity |
---|---|
Blastx | Plasma membrane ATPase 4 from Nicotiana with 90.03% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454461.1) |
Pfam | E1-E2 ATPase (PF00122.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer