Protein coding transcript 254387

• Transcript: Ll_transcript_33945
• CDS coordinates: 3-335 (+)
• Peptide sequence: IRATKCSKEGLSSEEGATRLEIFGPNKLEEKKESKFLKFLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFLGIICLLVINSTISFIEENNAGNAAAALMAGLAPKTK
• ORF Type: internal

Annotations of Ll_transcript_33945

• Blastp: ATPase 6, plasma membrane-type from Arabidopsis with 85.98% of identity
• Blastx: ATPase 6, plasma membrane-type from Arabidopsis with 85.98% of identity
• Eggnog: P-type atpase(COG0474)
• Kegg: Link to kegg annotations (AT2G07560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430612.1)
• Pfam: Cation transporter/ATPase, N-terminus (PF00690.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;