Transcript | Ll_transcript_33951 |
---|---|
CDS coordinates | 2-430 (+) |
Peptide sequence | QDFVGIICLLVINSTISFIEENNAGNAAAALMAGLAPKTKVLRDGKWSEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTRGSLPVTKDPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKRLTWWIAPTKLDIS |
ORF Type | internal |
Blastp | Plasma membrane ATPase 4 from Nicotiana with 93.02% of identity |
---|---|
Blastx | Plasma membrane ATPase 4 from Nicotiana with 93.02% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464790.1) |
Pfam | E1-E2 ATPase (PF00122.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer