Protein coding transcript 254405

• Transcript: Ll_transcript_35488
• CDS coordinates: 547-1086 (+)
• Peptide sequence: MGIFLMKWQWPWFLYVLLIHIVINKSKALSPDGEVLISFRTTVVSSYGVLLQWRPEDPDPCKWKGVKCDPKTKRVTHLSLSHCKLSGSLSPDLGKLGHLRVLALHNNNLYGTIPSALGNCTDLQGIFLQGNYLGGTIPGEIGNLSQLQNLDLSSNSLTGAIPASLGKLYSLKSFNVSANF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_35488

• Blastp: LRR receptor-like serine/threonine-protein kinase FEI 2 from Arabidopsis with 62.78% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase FEI 2 from Arabidopsis with 62.78% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G35620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423850.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;