Protein coding transcript 254409

• Transcript: Ll_transcript_35505
• CDS coordinates: 1-687 (+)
• Peptide sequence: NFNVSANFLDGTIPSDGVLANFTAGSFVGNRGLCGVQINSICKGSPGASNQSNSDQNQNGKKKYSGRLLISASATVGALLLVALMCFWGCFLYKKFGKNDKISLAMDVGGGASVVVFHGDLPYSSKDIIKKLETLNEEHIIGIGGFGKVYKLAMDDGNAFALKRIVKLNEGFDRFFERELEILGSIKHRYLVNLRGYCNSPTSKLLIYDYLPGGSLDEALHGTHSITL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_35505

• Blastp: LRR receptor-like serine/threonine-protein kinase FEI 1 from Arabidopsis with 78.83% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase FEI 1 from Arabidopsis with 77.83% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G31420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423850.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;