Transcript | Ll_transcript_35494 |
---|---|
CDS coordinates | 1-468 (+) |
Peptide sequence | PGEIGNLSQLQNLDISSNSLSGTIPPSLGKLYYLKNFNVSANFLSGTIPYDGVLANFTASSFSGNRGLCGVQINSKCKSSPDANSQSNLDINGKKKYSGPLLISSSATVGALLLVALMCFWGCFLYKKFGKNDRISLAMDVSGGASVVVFHGDLPY |
ORF Type | internal |
Blastp | LRR receptor-like serine/threonine-protein kinase FEI 1 from Arabidopsis with 62.26% of identity |
---|---|
Blastx | LRR receptor-like serine/threonine-protein kinase FEI 1 from Arabidopsis with 62.26% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT1G31420) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421715.1) |
Pfam | Leucine Rich Repeat (PF00560.32) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer