| Transcript | Ll_transcript_35709 |
|---|---|
| CDS coordinates | 2-319 (+) |
| Peptide sequence | QDAAAWLEYFESKALEQQEAARNGTPKPDASISSKGHLRTEVRDKRLVSYVNLMAFITYLHTRYALSQIHHLRFMLNWVTQVFISFKNWCPVCLSYLIYIMSCVS* |
| ORF Type | 5prime_partial |
| Blastp | Protein TSS from Arabidopsis with 100% of identity |
|---|---|
| Blastx | Protein TSS from Arabidopsis with 100% of identity |
| Eggnog | Involved in proper cytoplasmic distribution of mitochondria (By similarity)(ENOG410XQUQ) |
| Kegg | Link to kegg annotations (AT4G28080) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_012574966.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer