Protein coding transcript 254447

• Transcript: Ll_transcript_35698
• CDS coordinates: 990-1388 (+)
• Peptide sequence: MKSYGDLAVFYYRLQHTELALKYVTRALYLLHLTCGPSHPNTAATYINVAMMEEGLGNAHVALRYLHEALKCNKRLLGADHIQTAASYHAIAIALSLMEAYSLSVQHEQTTLQILQAKLGSDDLRTQDAAAWL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_35698

• Blastp: Protein TSS from Arabidopsis with 94.74% of identity
• Blastx: Protein TSS from Arabidopsis with 92.07% of identity
• Eggnog: Involved in proper cytoplasmic distribution of mitochondria (By similarity)(ENOG410XQUQ)
• Kegg: Link to kegg annotations (AT4G28080)
• CantataDB: Link to cantataDB annotations (CNT0001002)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429927.1)
• Pfam: Tetratricopeptide repeat (PF13424.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;