Protein coding transcript 2545

• Transcript: Ll_transcript_281130
• CDS coordinates: 130-444 (+)
• Peptide sequence: MQKMDDGDSTFKLSNSGLYFFISGNVDNCNNGEKLIVLVMAVRHKQVAPPLPERDLPPREVDPSTLVPMAQAPQKANSGSAKRVDVSFGVGVVIMYLSFGAGLV*
• ORF Type: complete

Annotations of Ll_transcript_281130

• Blastp: Early nodulin-like protein 2 from Arabidopsis with 35.62% of identity
• Blastx: Early nodulin-like protein 2 from Arabidopsis with 51.35% of identity
• Eggnog: Plastocyanin-like domain(ENOG411137T)
• Kegg: Link to kegg annotations (AT4G27520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451606.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;