Protein coding transcript 254550

• Transcript: Ll_transcript_33145
• CDS coordinates: 95-547 (+)
• Peptide sequence: MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKVLEEVALIPTKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDVSAIHTDHIEVDKETLEMLHALGLNDVPGIVQVEPTPVQPQFGFGRGGGAAPRRIIYYYHGGAC
• ORF Type: 3prime_partial

Annotations of Ll_transcript_33145

• Blastp: 40S ribosomal protein S17-4 from Arabidopsis with 81.69% of identity
• Blastx: 40S ribosomal protein S17-4 from Arabidopsis with 87.7% of identity
• Eggnog: Ribosomal protein(COG1383)
• Kegg: Link to kegg annotations (AT5G04800)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434834.1)
• Pfam: Ribosomal S17 (PF00833.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;