Transcript | Ll_transcript_33145 |
---|---|
CDS coordinates | 95-547 (+) |
Peptide sequence | MGRVRTKTVKKSSRQVIERYYSRMTLDFHTNKKVLEEVALIPTKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEEERERRMDFVPDVSAIHTDHIEVDKETLEMLHALGLNDVPGIVQVEPTPVQPQFGFGRGGGAAPRRIIYYYHGGAC |
ORF Type | 3prime_partial |
Blastp | 40S ribosomal protein S17-4 from Arabidopsis with 81.69% of identity |
---|---|
Blastx | 40S ribosomal protein S17-4 from Arabidopsis with 87.7% of identity |
Eggnog | Ribosomal protein(COG1383) |
Kegg | Link to kegg annotations (AT5G04800) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434834.1) |
Pfam | Ribosomal S17 (PF00833.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer