Protein coding transcript 2546

• Transcript: Ll_transcript_281102
• CDS coordinates: 109-468 (+)
• Peptide sequence: MLFIVALALLFGLFLALLFIPRHHKSGQKGNANSTLNNKDKASKSFTKSEVSLHHKRTDCWIIIKNKVYDVTPYVEEHPGGDAILAHAGDDSTEGFFGPQHATRVFDMIDDFYIGDLEQ*
• ORF Type: complete

Annotations of Ll_transcript_281102

• Blastp: Cytochrome B5-like protein from Arabidopsis with 57.26% of identity
• Blastx: Cytochrome B5-like protein from Arabidopsis with 82.43% of identity
• Eggnog: cytochrome b5(COG5274)
• Kegg: Link to kegg annotations (AT1G60660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458626.1)
• Pfam: Cytochrome b5-like Heme/Steroid binding domain (PF00173.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;