Protein coding transcript 254653

• Transcript: Ll_transcript_34174
• CDS coordinates: 136-1557 (+)
• Peptide sequence: MSSLIHFPAATSLSVTRAGDSVGFFVPTRRNCFTKTLNSRARCSLDSNVSDMSTNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRSNIGGKVGSFVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGANNNLLVKDHTHTFVNKGAEIGELDFRFLVGAPLHGIRAFLTTNQLQTYDKARNALALALSPVVRAVVDPDGALKDIRNLDSVSFSDWFLSKGGTRASIQRMWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDRGGRFHLRWGCREVLYDKSADGKTYVTGLSLSKATAKKIVKADAYVAACDVPGIKRLLPSEWRQHQFFNNIYELVGVPVITVQLRYNGWVTELQDLEKSRQLRRAVGLDNLLYTPDADFSCFADLALTSPEDYYIEGQGSLLQCVLTPGDPYMPLPNDEIISRVAKQVG*
• ORF Type: complete

Annotations of Ll_transcript_34174

• Blastp: Zeta-carotene desaturase, chloroplastic/chromoplastic from Tagetes with 81.66% of identity
• Blastx: Zeta-carotene desaturase, chloroplastic/chromoplastic from Tagetes with 81.66% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453327.1)
• Pfam: NAD(P)-binding Rossmann-like domain (PF13450.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;