Protein coding transcript 254654

• Transcript: Ll_transcript_34175
• CDS coordinates: 1189-2280 (+)
• Peptide sequence: MSTAVELLDQGHEVDIYESRSFIGGKVGSFVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGANNNLLVKDHTHTFVNKGGQVGELDFRFLVGAPLHGIRAFLTTNQLKTYDKARNALALALSPVVRALVDPDGALQDIRNLDGVSFSDWFLSKGGTRASIQRMWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDRGGRFHLRWGCREILYGNSADGSTFVTGLSMSKATDKKIVKADAYVAACDVPGIKRLLPSEWRQHQFFDNIYELVGVPVVTVQLRYNGWVTELQDLEMSRQLRKAIGLDNLLYTPDADFSCFADLALTSPEDYYIEGQGSLLQ*
• ORF Type: complete

Annotations of Ll_transcript_34175

• Blastp: Zeta-carotene desaturase, chloroplastic/chromoplastic from Narcissus with 87.33% of identity
• Blastx: Zeta-carotene desaturase, chloroplastic/chromoplastic from Narcissus with 86.68% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439955.1)
• Pfam: Flavin containing amine oxidoreductase (PF01593.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;