Protein coding transcript 254656

• Transcript: Ll_transcript_34154
• CDS coordinates: 136-1152 (+)
• Peptide sequence: MSSLIHFPAATSLSVTRAGDSVGFFVPTRRNCFTKTLNSRARCSLDSNVSDMSTNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRSNIGGKVGSFVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGANNNLLVKDHTHTFVNKGGQVGELDFRFLVGAPLHGIRAFLTTNQLKTYDKARNALALALSPVVRALVDPDGALQDIRNLDGVSFSDWFLSKGGTRASIQRMWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDRGGRYNFRHEDIAMMIIQIPSYLDSHSLLKQVPS*
• ORF Type: complete

Annotations of Ll_transcript_34154

• Blastp: Zeta-carotene desaturase, chloroplastic/chromoplastic from Capsicum with 86.16% of identity
• Blastx: Zeta-carotene desaturase, chloroplastic/chromoplastic from Capsicum with 88.81% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAA61985)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453327.1)
• Pfam: NAD(P)-binding Rossmann-like domain (PF13450.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;