Transcript | Ll_transcript_34195 |
---|---|
CDS coordinates | 2-1279 (+) |
Peptide sequence | FGFGKDQSCCSPHCKVLATPTLSTKTPLSILHIPFSLQCHLFILLQFMLFLTHTNTTYTHNLKLLSLFSFLFQQKTMMTSLIHCPAPTSLSVNRGGDSFGFFVPTNNNRFSKTLKSRIRCSLDSNVSDMSTNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRSIIGGKVGSFVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGAHNNLLVKDHTHTFVNKGGEIGELDFRFLVGAPLHGIKAFLTTNQLKTYDKARNAVALALSPVVRALVDPDGALRDIRNLDSISFSDWFLSKGGTRPSIKRMWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDRGGRFHLRWGCREVLYDKSADGKTYVTGLSLSKVICFMCSFLKS* |
ORF Type | 5prime_partial |
Blastp | Zeta-carotene desaturase, chloroplastic/chromoplastic from Capsicum with 81.16% of identity |
---|---|
Blastx | Zeta-carotene desaturase, chloroplastic/chromoplastic from Capsicum with 76.81% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (CAA61985) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453327.1) |
Pfam | NAD(P)-binding Rossmann-like domain (PF13450.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer