Protein coding transcript 254678

• Transcript: Ll_transcript_34156
• CDS coordinates: 1189-2082 (+)
• Peptide sequence: MSTAVELLDQGHEVDIYESRSIIGGKVGSFVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGANNNLLVKDHTHTFVNKGAEIGELDFRFLVGAPLHGIRAFLTTNQLQTYDKARNALALALSPVVRAVVDPDGALKDIRNLDSVSFSDWFLSKGGTRASIQRMWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDRGGRFHLRWGCREVLYDKSADGKTYVTGLSLSKATAKKIVKADAYVAACDVPGIKRLLPSEWRQHQFFFFFYELVGVP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_34156

• Blastp: Zeta-carotene desaturase, chloroplastic/chromoplastic from Arabidopsis with 85.91% of identity
• Blastx: Zeta-carotene desaturase, chloroplastic/chromoplastic from Tagetes with 86.24% of identity
• Eggnog: Desaturase(COG3349)
• Kegg: Link to kegg annotations (AT3G04870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453327.1)
• Pfam: Flavin containing amine oxidoreductase (PF01593.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;