Protein coding transcript 254679

• Transcript: Ll_transcript_34202
• CDS coordinates: 136-1350 (+)
• Peptide sequence: MSSLIHFPAATSLSVTRAGDSVGFFVPTRRNCFTKTLNSRARCSLDSNVSDMSTNAPKGLFPPEPERYRGPKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRSNIGGKVGSFVDKQGNHIEMGLHVFFGCYNNLFRLMKKVGANNNLLVKDHTHTFVNKGGQVGELDFRFLVGAPLHGIRAFLTTNQLKTYDKARNALALALSPVVRALVDPDGALQDIRNLDGVSFSDWFLSKGGTRASIQRMWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDRGGRFHLRWGCREILYGNSADGSTFVTGLSMSKATDKKIVKADAYVAACDVPGIKRLLPSEWRQHQFFDNIYELVGVPVVTVQLRYNGWVTELQDLEMSR*
• ORF Type: complete

Annotations of Ll_transcript_34202

• Blastp: Zeta-carotene desaturase, chloroplastic/chromoplastic from Lycopersicon with 84.72% of identity
• Blastx: Zeta-carotene desaturase, chloroplastic/chromoplastic from Lycopersicon with 77.17% of identity
• Eggnog: Desaturase(COG3349)
• Kegg: Link to kegg annotations (543629)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453327.1)
• Pfam: NAD(P)-binding Rossmann-like domain (PF13450.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;