Protein coding transcript 254682

• Transcript: Ll_transcript_34205
• CDS coordinates: 864-2135 (+)
• Peptide sequence: MLLIMRFQLYIWVSFPVPNTHMSMPIHTCTCTNIHIHTTRNSKDLQHFTSYQLCFSVFCSSDHFTYSLQVSFSDWFLSKGGTRASIQRMWDPVAYALGFIDCDNISARCMLTIFALFATKTEASLLRMLKGSPDVYLSGPIRKYITDRGGRFHLRWGCREILYGNSADGSTFVTGLSMSKATDKKIVKADAYVAACDVPGIKRLLPSEWRQHQFFDNIYELVGVPVVTVQLRYNGWVTELQDLEMSRQLRKAIGLDNLLYTPDADFSCFADLALTSPEDYYIEGQGSLLQCVLTPGDPYMPLPNDEIVGRVAKQVLSLFPSAQGLEVTWSSVVKIGQSLYREGPGKDPFRPDQKTPVKNFFLSGSYTKQDYIDSMEGATLSGRQASAYICDAGEELVALRKELDAEFKDDLKFSNTNDELSLV*
• ORF Type: complete

Annotations of Ll_transcript_34205

• Blastp: Zeta-carotene desaturase, chloroplastic/chromoplastic from Lycopersicon with 84.83% of identity
• Blastx: Zeta-carotene desaturase, chloroplastic/chromoplastic from Lycopersicon with 84.83% of identity
• Eggnog: Desaturase(COG3349)
• Kegg: Link to kegg annotations (543629)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439955.1)
• Pfam: Flavin containing amine oxidoreductase (PF01593.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;