Transcript | Ll_transcript_281095 |
---|---|
CDS coordinates | 300-1766 (+) |
Peptide sequence | MSVSHLTLCSLSSFILALLLIFILFKRKQTKPKLNLPPGKMGWPFIGETIGYLKPYSATTIGEFMDQHIARYGKIYKSKLFGEPAIVSADAGLNRFILQNEGKLFECSYPRSIGGILGKWSMLVLVGDMHRDMRTISLNFLSHARLRTHMMKDVEKHTLLVLRSWKENSTFSAQDEAKKFTFNLVAKHILNLDPGNIETEQLRKEYVTFMKGVVSVPLNLPGTAYRKALKSRCTILKLIEGKMEERVQRIQEGNESLEEEDLLNWVLKHSSLSTEQILDLILSLLFAGHETSSVSIALAIYFLPGCPQAMQQLKEEHREIARAKKQAGKVELTWDDYKKMEFTHCVVNETLRLGNVVRFLHRKAIKDVRYKGYDIPCGWKVLPVIAAVHLDPSLFDQPQRFNPWRWQNSGSRGSCPSMSTVSNNFLPFGGGPRLCAGSELAKLEMAVFIHHLILNYHWELTDTDEAFAYPFVDFPKGLPIKVKAHSLL* |
ORF Type | complete |
Blastp | Cytochrome P450 90B1 from Arabidopsis with 72.56% of identity |
---|---|
Blastx | Cytochrome P450 90B1 from Arabidopsis with 72.97% of identity |
Eggnog | Cytochrome p450(COG2124) |
Kegg | Link to kegg annotations (AT3G50660) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422263.1) |
Pfam | Cytochrome P450 (PF00067.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer