Protein coding transcript 254704

• Transcript: Ll_transcript_33832
• CDS coordinates: 306-605 (+)
• Peptide sequence: MTSNLGAEHLLTGLSGKCTMQVARDKVMQEVRRHFRPELLNRLDEIVVFDPLSHEQLRKVARLQMKDVASRLAERGIALAVTDAALDYILAESYDPVST*
• ORF Type: complete

Annotations of Ll_transcript_33832

• Blastp: Chaperone protein ClpB1 from Arabidopsis with 89.69% of identity
• Blastx: Chaperone protein ClpB1 from Arabidopsis with 90% of identity
• Eggnog: ATP-dependent CLP protease ATP-binding subunit(COG0542)
• Kegg: Link to kegg annotations (AT1G74310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013457977.1)
• Pfam: AAA domain (Cdc48 subfamily) (PF07724.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;