Protein coding transcript 254710

• Transcript: Ll_transcript_33824
• CDS coordinates: 438-887 (+)
• Peptide sequence: MSSPTSRNPKPIPTWDSIAKAASFNLNHQPFFAASAPASPTHRHLYTPPTIPECDESDTSTVESGQWLNFQQAFAPSVASALPFCPNLSFSMGHPVQQQQHPLPDNSGKMQQMTISEAGFGVQVKPWVGEKIHEVGLDDLELTLGSGKN*
• ORF Type: complete

Annotations of Ll_transcript_33824

• Blastp: Protein BRASSINAZOLE-RESISTANT 1 from Arabidopsis with 53.99% of identity
• Blastx: Protein BRASSINAZOLE-RESISTANT 1 from Arabidopsis with 55.86% of identity
• Eggnog: brassinazole-resistant(ENOG41116W9)
• Kegg: Link to kegg annotations (AT1G75080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414982.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;